PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf00052g04002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family M-type_MADS
Protein Properties Length: 72aa    MW: 8307.68 Da    PI: 11.1358
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf00052g04002.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF90.77.5e-29959151
                              S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                    SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                              kri+nk  rqvtfskRr+g++KKA+ELS+LCd++vav++fs++g+ly++ss
  Peinf101Scf00052g04002.1  9 KRIQNKNSRQVTFSKRRKGLIKKAKELSILCDVDVAVVVFSNRGRLYDFSS 59
                              79***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.2E-37160IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.83E-29169IPR002100Transcription factor, MADS-box
PROSITE profilePS5006630.74161IPR002100Transcription factor, MADS-box
CDDcd002655.49E-33271No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004044.1E-28323IPR002100Transcription factor, MADS-box
PfamPF003195.0E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004044.1E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004044.1E-283859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 72 aa     Download sequence    Send to blast
MGRKKVEIKR IQNKNSRQVT FSKRRKGLIK KAKELSILCD VDVAVVVFSN RGRLYDFSST  60
NREGVSTTYD KI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P3e-20169169Myocyte-specific enhancer factor 2B
1tqe_Q3e-20169169Myocyte-specific enhancer factor 2B
1tqe_R3e-20169169Myocyte-specific enhancer factor 2B
1tqe_S3e-20169169Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY3705294e-82AY370529.1 Petunia x hybrida MADS-box protein 15 (PMADS15) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009804704.16e-34PREDICTED: agamous-like MADS-box protein AGL27
RefseqXP_009795053.19e-34PREDICTED: agamous-like MADS-box protein AGL27 isoform X2
RefseqXP_016435773.19e-34PREDICTED: agamous-like MADS-box protein AGL27 isoform X2
RefseqXP_009795052.11e-33PREDICTED: agamous-like MADS-box protein AGL27 isoform X1
RefseqXP_016435771.11e-33PREDICTED: agamous-like MADS-box protein AGL27 isoform X1
SwissprotQ9M2K83e-27AGL18_ARATH; Agamous-like MADS-box protein AGL18
TrEMBLQ6UGQ63e-33Q6UGQ6_PETHY; MADS-box protein 15
STRINGSolyc12g087820.1.12e-31(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4024625
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G57390.12e-28AGAMOUS-like 18